SCOPe 2.08: Domain d6c44b_: 6c44 B:

Lineage for d6c44b_ (6c44 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily)
   core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices

4. Superfamily a.190.1: Flavivirus capsid protein C [101257] (2 families)
   automatically mapped to Pfam PF01003

5. Family a.190.1.0: automated matches [348805] (1 protein)
   not a true family

6. Protein automated matches [348806] (3 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [362076] (1 PDB entry)

8. Domain d6c44b_: 6c44 B: [362080]
   automated match to d1r6ra_

Details for d6c44b_

PDB Entry: 6c44

PDB Description: zika virus capsid protein

PDB Compounds: (B:) capsid protein

SCOPe Domain Sequences for d6c44b_:

Sequence; same for both SEQRES and ATOM records:

>d6c44b_ a.190.1.0 (B:) automated matches {Zika virus [TaxId: 64320]}
aglllghgpirmvlailaflrftaikpslglinrwgsvgkkeameiikkfkkdlaamlri
inarkekkrr

Timeline for d6c44b_:

• d6c44b_ first appeared in SCOPe 2.07