Lineage for d6abwa_ (6abw A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722943Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2722944Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2722945Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2723011Protein automated matches [190675] (10 species)
    not a true protein
  7. 2723032Species Metallosphaera sedula [TaxId:399549] [362007] (2 PDB entries)
  8. 2723033Domain d6abwa_: 6abw A: [362067]
    automated match to d1vgma_
    complexed with aco, gol

Details for d6abwa_

PDB Entry: 6abw (more details), 1.72 Å

PDB Description: crystal structure of citrate synthase (msed_0281) from metallosphaera sedula in complex with acetyl-coa
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d6abwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6abwa_ a.103.1.1 (A:) automated matches {Metallosphaera sedula [TaxId: 399549]}
envfikttsltyidgengilryggydiedlvehtsfeevvhlmlygdlptklqlqrlksa
ldeayevpqqvidmiyslprdsdavgmmetafsalssiygmpwnkatnrdnavklvaras
tvvanvlrakegkkpaipepsesfaksflkasfsrtpteeevkamdaalilyadhevpas
ttaalvtsstlsdiyscvvaalaalkgplhggaaeeafkqfveigepdmteswfkrkiie
gksrlmgfghrvyktydprakifkkyakvisernsdarkyfeiaqkleelgvetfgakhi
ypntdfysgvvfyalgfpvymftslfalsrtlgwtahvieyvedqhrlirpralyvgplk
rdvvpielr

SCOPe Domain Coordinates for d6abwa_:

Click to download the PDB-style file with coordinates for d6abwa_.
(The format of our PDB-style files is described here.)

Timeline for d6abwa_: