Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (44 species) not a true protein |
Species Amphitrite ornata [TaxId:129555] [189339] (41 PDB entries) |
Domain d6ch5b_: 6ch5 B: [362053] automated match to d5lkva_ complexed with f0m, gol, hem, peg, so4 |
PDB Entry: 6ch5 (more details), 1.65 Å
SCOPe Domain Sequences for d6ch5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ch5b_ a.1.1.2 (B:) automated matches {Amphitrite ornata [TaxId: 129555]} gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw drfgknlvsalssagmk
Timeline for d6ch5b_: