Lineage for d6c1oa_ (6c1o A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein Fibroblast growth factor receptor 1 [56158] (1 species)
    PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase
  7. Species Human (Homo sapiens) [TaxId:9606] [56159] (47 PDB entries)
  8. Domain d6c1oa_: 6c1o A: [362042]
    automated match to d4v04b_
    complexed with mk9, so4

Details for d6c1oa_

PDB Entry: 6c1o (more details), 2.29 Å

PDB Description: fgfr1 kinase domain complexed with fiin-1
PDB Compounds: (A:) fibroblast growth factor receptor 1

SCOPe Domain Sequences for d6c1oa_:

Sequence, based on SEQRES records: (download)

>d6c1oa_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley
synpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
lardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypg
vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn
qe

Sequence, based on observed residues (ATOM records): (download)

>d6c1oa_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppynps
hnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgllpvk
wmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnc
tnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe

SCOPe Domain Coordinates for d6c1oa_ are not available.

Timeline for d6c1oa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6c1ob_