SCOPe 2.08: Domain d6c55a2: 6c55 A:183-327

Lineage for d6c55a2 (6c55 A:183-327)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:273036] [340197] (4 PDB entries)

8. Domain d6c55a2: 6c55 A:183-327 [362026]
   Other proteins in same PDB: d6c55a1, d6c55b1
   automated match to d4kqxb2
   complexed with eka, ekd, mg, nap

Details for d6c55a2

PDB Entry: 6c55, 2.09 Å

PDB Description: crystal structure of staphylococcus aureus ketol-acid reductosimerrase with hydroxyoxamate inhibitor 3

PDB Compounds: (A:) Ketol-acid reductoisomerase (NADP(+))

SCOPe Domain Sequences for d6c55a2:

Sequence; same for both SEQRES and ATOM records:

>d6c55a2 a.100.1.0 (A:183-327) automated matches {Staphylococcus aureus [TaxId: 273036]}
fkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmyegg
menvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfkefy
klreeqhghqiekvgrelremmpfi

Timeline for d6c55a2:

• d6c55a2 first appeared in SCOPe 2.07