Lineage for d6al3d_ (6al3 D:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. Protein automated matches [190139] (27 species)
    not a true protein
  7. Species Protobothrops flavoviridis [TaxId:88087] [362001] (1 PDB entry)
  8. Domain d6al3d_: 6al3 D: [362005]
    automated match to d1goda_
    complexed with so4

Details for d6al3d_

PDB Entry: 6al3 (more details), 2.57 Å

PDB Description: lys49 pla2 bpii derived from the venom of protobothrops flavoviridis.
PDB Compounds: (D:) Basic phospholipase A2 BP-II

SCOPe Domain Sequences for d6al3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6al3d_ a.133.1.2 (D:) automated matches {Protobothrops flavoviridis [TaxId: 88087]}
slvqlwkmifqetgkeaaknyglygcncgvgrrgkpkdatdsccyvhkccykkvtgcnpk
mdsysyswknkaivcgeknppclkqvcecdkavaiclrenlgtynkkytiypkpfckkad
tc

SCOPe Domain Coordinates for d6al3d_ are not available.

Timeline for d6al3d_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6al3a_, d6al3b_, d6al3c_