Lineage for d6aksb_ (6aks B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822534Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2822535Protein automated matches [190988] (51 species)
    not a true protein
  7. 2822541Species Coxsackievirus a10 [TaxId:42769] [359971] (7 PDB entries)
  8. 2822553Domain d6aksb_: 6aks B: [362000]
    Other proteins in same PDB: d6aksc_
    automated match to d4jgyb_
    complexed with sph

Details for d6aksb_

PDB Entry: 6aks (more details), 3 Å

PDB Description: cryo-em structure of cva10 mature virus
PDB Compounds: (B:) vp2

SCOPe Domain Sequences for d6aksb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aksb_ b.121.4.0 (B:) automated matches {Coxsackievirus a10 [TaxId: 42769]}
sdrvaqltvgnssittqeaanivlaygewpeycpdtdatavdkptrpdvsvnrfytldsk
mwqenstgwywkfpdvlnktgvfgqnaqfhylyrsgfclhvqcnaskfhqgallvavipe
fviagrgsntkpneaphpgftttfpgttgatfhdpyvldsgvplsqaliyphqwinlrtn
ncatvivpyinavpfdsainhsnfglivipvsplkyssgattaipititiaplnsefggl
rqavsq

SCOPe Domain Coordinates for d6aksb_:

Click to download the PDB-style file with coordinates for d6aksb_.
(The format of our PDB-style files is described here.)

Timeline for d6aksb_: