Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein automated matches [190068] (13 species) not a true protein |
Species Streptomyces sp. [TaxId:1525753] [361998] (1 PDB entry) |
Domain d6a7ia1: 6a7i A:1-407 [361999] Other proteins in same PDB: d6a7ia2 automated match to d1gwib_ complexed with hem |
PDB Entry: 6a7i (more details), 2.19 Å
SCOPe Domain Sequences for d6a7ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a7ia1 a.104.1.1 (A:1-407) automated matches {Streptomyces sp. [TaxId: 1525753]} mtrialdpfvrdldgesaalraagplaevelpggvhvyavtrhaearalltdsrvvkdid vwnawrrgeipmdwpliglanpgrsmltvdgadhrrlrtlvaqaltvkrverlragieal tnasleklaalpagepvdlkaefayplpmnviselmgvdaadhprlkelfekffstqtpp eevpqmmadlgalftkivdakrtnpgddltsaliaasengdhltdeeivntlqliiaagh ettislivnvvealqthpeqrkkvlngeigwdgvieetlrwntptshvlirfatedievg dkilpkgegliisfgalgrdeeqygptagefdatrtpnrhiafghgphvcpgaalsrlea gialpalyerfpeldlavpasdlrnkpivtqndlhelpvklgcpfgg
Timeline for d6a7ia1: