Lineage for d5z2bb2 (5z2b B:159-310)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. Protein automated matches [254656] (4 species)
    not a true protein
  7. Species Bacillus sp. [TaxId:36824] [312567] (12 PDB entries)
  8. Domain d5z2bb2: 5z2b B:159-310 [361996]
    automated match to d1j2ga2
    complexed with aza, cl, edo, oxy, so4; mutant

Details for d5z2bb2

PDB Entry: 5z2b (more details), 1.9 Å

PDB Description: crystal structure of highly active btuo mutant p287g improved by humidity control at 86% rh
PDB Compounds: (B:) Uric acid degradation bifunctional protein

SCOPe Domain Sequences for d5z2bb2:

Sequence, based on SEQRES records: (download)

>d5z2bb2 d.96.1.4 (B:159-310) automated matches {Bacillus sp. [TaxId: 36824]}
dntlniteqqsglaglqlikvsgnsfvgfirdeyttlpedsnrplfvylnikwkyknted
sfgtnpenyvaaeqirdiatsvfhetetlsiqhliyligrrilerfpqlqevyfesqnht
wdkiveeigesegkvyteprppygfqcftvtq

Sequence, based on observed residues (ATOM records): (download)

>d5z2bb2 d.96.1.4 (B:159-310) automated matches {Bacillus sp. [TaxId: 36824]}
dntlniteqqsglaglqlikvsgnsfvgfirdeyttlpedsnrplfvylnikwkyknted
sfgtnpenyvaaeqirdiatsvfhetetlsiqhliyligrrilerfpqlqevyfesqnht
wdkiegkvyteprppygfqcftvtq

SCOPe Domain Coordinates for d5z2bb2 are not available.

Timeline for d5z2bb2:

Domains from same chain:
(mouse over for more information)
d5z2bb1
Domains from other chains:
(mouse over for more information)
d5z2ba1, d5z2ba2