SCOPe 2.07: Domain d5ziqb1: 5ziq B:37-190

Lineage for d5ziqb1 (5ziq B:37-190)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (26 species)
   not a true protein

7. Species Ramazzottius varieornatus [TaxId:947166] [361948] (2 PDB entries)

8. Domain d5ziqb1: 5ziq B:37-190 [361991]
   Other proteins in same PDB: d5ziqa2, d5ziqb2, d5ziqc2
   automated match to d1hbra_
   complexed with edo, hem, so4

Details for d5ziqb1

PDB Entry: 5ziq, 1.5 Å

PDB Description: crystal structure of hexacoordinated heme protein from anhydrobiotic tardigrade at ph 4

PDB Compounds: (B:) Globin protein

SCOPe Domain Sequences for d5ziqb1:

Sequence; same for both SEQRES and ATOM records:

>d5ziqb1 a.1.1.0 (B:37-190) automated matches {Ramazzottius varieornatus [TaxId: 947166]}
dprfpltardkfslvkswktfsrnlesagkemllklfiehpdmkdlfpkfkaktpdqlrn
desfeeaalahitpydqavqdsdnvdilltnlkrvgrqhktvpgfqesyfermekclvfa
lqttladaytenmeriykiwiswttekiregfre

Timeline for d5ziqb1:

• d5ziqb1 is new in SCOPe 2.07-stable
  
• d5ziqb1 appears in the current release, SCOPe 2.08