Lineage for d5ziqb1 (5ziq B:37-190)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. Protein automated matches [190590] (26 species)
    not a true protein
  7. Species Ramazzottius varieornatus [TaxId:947166] [361948] (2 PDB entries)
  8. Domain d5ziqb1: 5ziq B:37-190 [361991]
    Other proteins in same PDB: d5ziqa2, d5ziqb2, d5ziqc2
    automated match to d1hbra_
    complexed with edo, hem, so4

Details for d5ziqb1

PDB Entry: 5ziq (more details), 1.5 Å

PDB Description: crystal structure of hexacoordinated heme protein from anhydrobiotic tardigrade at ph 4
PDB Compounds: (B:) Globin protein

SCOPe Domain Sequences for d5ziqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ziqb1 a.1.1.0 (B:37-190) automated matches {Ramazzottius varieornatus [TaxId: 947166]}
dprfpltardkfslvkswktfsrnlesagkemllklfiehpdmkdlfpkfkaktpdqlrn
desfeeaalahitpydqavqdsdnvdilltnlkrvgrqhktvpgfqesyfermekclvfa
lqttladaytenmeriykiwiswttekiregfre

SCOPe Domain Coordinates for d5ziqb1 are not available.

Timeline for d5ziqb1:

Domains from same chain:
(mouse over for more information)
d5ziqb2
Domains from other chains:
(mouse over for more information)
d5ziqa1, d5ziqa2, d5ziqc1, d5ziqc2, d5ziqd_