Lineage for d5z3ia_ (5z3i A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. Protein automated matches [190420] (9 species)
    not a true protein
  7. Species Abrus precatorius [TaxId:3816] [189038] (4 PDB entries)
  8. Domain d5z3ia_: 5z3i A: [361977]
    automated match to d1abra_
    complexed with ade

Details for d5z3ia_

PDB Entry: 5z3i (more details), 1.6500000000000001 Å

PDB Description: crystal structure of abrin a chain (recombinant) in complex with adenine at 1.65 angstroms
PDB Compounds: (A:) Abrin A-chain

SCOPe Domain Sequences for d5z3ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z3ia_ d.165.1.1 (A:) automated matches {Abrus precatorius [TaxId: 3816]}
rpikfstegatsqsykqfiealrerlrgglihdipvlpdpttlqernryitvelsnsdte
sievgidvtnayvvayragtqshflrdapssasdylftgtdqhslpfygtygdlerwahq
srqqiplglqalthgisffrsggndneekartliviiqmvaeaarfryisnrvrvsiqtg
tafqpdaamislennwdnlsrgvqesvqdtfpnqvtltnirnepvivdslshptvavlal
mlfvcnp

SCOPe Domain Coordinates for d5z3ia_ are not available.

Timeline for d5z3ia_: