Lineage for d5ziqd_ (5ziq D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689535Species Ramazzottius varieornatus [TaxId:947166] [361948] (2 PDB entries)
  8. 2689539Domain d5ziqd_: 5ziq D: [361949]
    Other proteins in same PDB: d5ziqa2, d5ziqb2, d5ziqc2
    automated match to d1hbra_
    complexed with edo, hem, so4

Details for d5ziqd_

PDB Entry: 5ziq (more details), 1.5 Å

PDB Description: crystal structure of hexacoordinated heme protein from anhydrobiotic tardigrade at ph 4
PDB Compounds: (D:) Globin protein

SCOPe Domain Sequences for d5ziqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ziqd_ a.1.1.0 (D:) automated matches {Ramazzottius varieornatus [TaxId: 947166]}
rfpltardkfslvkswktfsrnlesagkemllklfiehpdmkdlfpkfkaktpdqlrnde
sfeeaalahitpydqavqdsdnvdilltnlkrvgrqhktvpgfqesyfermekclvfalq
ttladaytenmeriykiwiswttekiregfre

SCOPe Domain Coordinates for d5ziqd_:

Click to download the PDB-style file with coordinates for d5ziqd_.
(The format of our PDB-style files is described here.)

Timeline for d5ziqd_: