Lineage for d5z2ab2 (5z2a B:159-310)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2572796Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2572797Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2573111Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. 2573346Protein automated matches [254656] (4 species)
    not a true protein
  7. 2573431Species Bacillus sp. [TaxId:36824] [312567] (14 PDB entries)
  8. 2573491Domain d5z2ab2: 5z2a B:159-310 [361936]
    automated match to d1j2ga2
    complexed with aza, cl, edo, oxy, so4

Details for d5z2ab2

PDB Entry: 5z2a (more details), 1.72 Å

PDB Description: crystal structure of bacillus sp. tb-90 urate oxidase improved by humidity control at 86% rh.
PDB Compounds: (B:) Uric acid degradation bifunctional protein

SCOPe Domain Sequences for d5z2ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z2ab2 d.96.1.4 (B:159-310) automated matches {Bacillus sp. [TaxId: 36824]}
dntlniteqqsglaglqlikvsgnsfvgfirdeyttlpedsnrplfvylnikwkyknted
sfgtnpenyvaaeqirdiatsvfhetetlsiqhliyligrrilerfpqlqevyfesqnht
wdkiveeipesegkvyteprppygfqcftvtq

SCOPe Domain Coordinates for d5z2ab2:

Click to download the PDB-style file with coordinates for d5z2ab2.
(The format of our PDB-style files is described here.)

Timeline for d5z2ab2:

  • d5z2ab2 is new in SCOPe 2.07-stable
  • d5z2ab2 does not appear in SCOPe 2.08

View in 3D
Domains from same chain:
(mouse over for more information)
d5z2ab1