SCOPe 2.07: Domain d6i8nb_: 6i8n B:

Lineage for d6i8nb_ (6i8n B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:416870] [188710] (8 PDB entries)

8. Domain d6i8nb_: 6i8n B: [361911]
   automated match to d3f8fa_
   complexed with hox, mpo

Details for d6i8nb_

PDB Entry: 6i8n, 1.79 Å

PDB Description: crystal structure of lmrr with v15 replaced by unnatural amino acid 4- amino-l-phenylalanine

PDB Compounds: (B:) Transcriptional regulator, PadR-like family

SCOPe Domain Sequences for d6i8nb_:

Sequence; same for both SEQRES and ATOM records:

>d6i8nb_ a.4.5.0 (B:) automated matches {Lactococcus lactis [TaxId: 416870]}
aeipkemlraqtnxillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdg
iissywgdesqggrrkyyrlteighenmrlafeswsrvdkiienleankkseai

Timeline for d6i8nb_:

• d6i8nb_ is new in SCOPe 2.07-stable
  
• d6i8nb_ appears in the current release, SCOPe 2.08