![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Lactococcus lactis [TaxId:416870] [188710] (8 PDB entries) |
![]() | Domain d6i8nb_: 6i8n B: [361911] automated match to d3f8fa_ complexed with hox, mpo |
PDB Entry: 6i8n (more details), 1.79 Å
SCOPe Domain Sequences for d6i8nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i8nb_ a.4.5.0 (B:) automated matches {Lactococcus lactis [TaxId: 416870]} aeipkemlraqtnxillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdg iissywgdesqggrrkyyrlteighenmrlafeswsrvdkiienleankkseai
Timeline for d6i8nb_: