Lineage for d6ahsa_ (6ahs A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (36 species)
    not a true protein
  7. 2798506Species Mouse (Mus musculus) [TaxId:10090] [354106] (3 PDB entries)
  8. 2798507Domain d6ahsa_: 6ahs A: [361910]
    automated match to d2qxia_
    complexed with 9yo, cl, trs

Details for d6ahsa_

PDB Entry: 6ahs (more details), 1.75 Å

PDB Description: mouse kallikrein 7 in complex with imidazolinylindole derivative
PDB Compounds: (A:) Kallikrein-7

SCOPe Domain Sequences for d6ahsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ahsa_ b.47.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iidgykckegshpwqvallkgnqlhcggvlvdkywvltaahckmgqyqvqlgsdkigdqs
aqkikatksfrhpgystkthvndimlvrldepvkmsskveavqlpehceppgtsctvsgw
gtttspdvtfpsdlmcsdvklissreckkvykdllgktmlcagipdsktntcngdsggpl
vcndtlqglvswgtypcgqpndpgvytqvckykrwvmetmkthr

SCOPe Domain Coordinates for d6ahsa_:

Click to download the PDB-style file with coordinates for d6ahsa_.
(The format of our PDB-style files is described here.)

Timeline for d6ahsa_: