Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (36 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [354106] (3 PDB entries) |
Domain d6ahsa_: 6ahs A: [361910] automated match to d2qxia_ complexed with 9yo, cl, trs |
PDB Entry: 6ahs (more details), 1.75 Å
SCOPe Domain Sequences for d6ahsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ahsa_ b.47.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iidgykckegshpwqvallkgnqlhcggvlvdkywvltaahckmgqyqvqlgsdkigdqs aqkikatksfrhpgystkthvndimlvrldepvkmsskveavqlpehceppgtsctvsgw gtttspdvtfpsdlmcsdvklissreckkvykdllgktmlcagipdsktntcngdsggpl vcndtlqglvswgtypcgqpndpgvytqvckykrwvmetmkthr
Timeline for d6ahsa_: