Lineage for d6a9aa_ (6a9a A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972197Protein dCMP hydroxymethylase [55843] (1 species)
  7. 2972198Species Bacteriophage T4 [TaxId:10665] [55844] (6 PDB entries)
  8. 2972201Domain d6a9aa_: 6a9a A: [361905]
    automated match to d1b5da_
    complexed with dcm, iod, thg

Details for d6a9aa_

PDB Entry: 6a9a (more details), 1.9 Å

PDB Description: ternary complex crystal structure of dch with dcmp and thf
PDB Compounds: (A:) Deoxycytidylate 5-hydroxymethyltransferase

SCOPe Domain Sequences for d6a9aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a9aa_ d.117.1.1 (A:) dCMP hydroxymethylase {Bacteriophage T4 [TaxId: 10665]}
misdsmtveeirlhlglalkekdfvvdktgvktieiigasfvadepfifgalndeyiqre
lewykskslfvkdipgetpkiwqqvasskgeinsnygwaiwsednyaqydmclaelgqnp
dsrrgimiytrpsmqfdynkdgmsdfmstntvqylirdkkinavvnmrsndvvfgfrnny
awqkyvldklvsdlnagdstrqykagsiiwnvgslhvysrhfylvdhwwktgethiskkd
yvgkya

SCOPe Domain Coordinates for d6a9aa_:

Click to download the PDB-style file with coordinates for d6a9aa_.
(The format of our PDB-style files is described here.)

Timeline for d6a9aa_: