Lineage for d5z0xb_ (5z0x B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. Protein Pseudoazurin [49522] (4 species)
  7. Species Achromobacter cycloclastes [TaxId:223] [49525] (14 PDB entries)
  8. Domain d5z0xb_: 5z0x B: [361895]
    automated match to d2jkwa_
    complexed with cu, gol

Details for d5z0xb_

PDB Entry: 5z0x (more details), 1.46 Å

PDB Description: x-ray crystal structure of pseudoazurin met16tyr variant
PDB Compounds: (B:) pseudoazurin

SCOPe Domain Sequences for d5z0xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z0xb_ b.6.1.1 (B:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]}
adfevhmlnkgkdgayvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
algn

SCOPe Domain Coordinates for d5z0xb_ are not available.

Timeline for d5z0xb_:

Domains from other chains:
(mouse over for more information)
d5z0xa_