Lineage for d5zbmb_ (5zbm B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. Protein automated matches [190228] (20 species)
    not a true protein
  7. Species Nicotiana benthamiana [TaxId:4100] [361819] (2 PDB entries)
  8. Domain d5zbmb_: 5zbm B: [361880]
    automated match to d1gyla_
    complexed with fmn

Details for d5zbmb_

PDB Entry: 5zbm (more details), 2.8 Å

PDB Description: structure of glycolate oxidase containing fmn from nicotiana benthamiana
PDB Compounds: (B:) glycolate oxidase

SCOPe Domain Sequences for d5zbmb_:

Sequence, based on SEQRES records: (download)

>d5zbmb_ c.1.4.1 (B:) automated matches {Nicotiana benthamiana [TaxId: 4100]}
evtnvmeyeaiakkklpkmvfdyyasgaedqwtlaenrnafsrilfrprilidvskidms
ttvlgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevastgp
girffqlyvykdrnvvaqlvrraeragfkaialtvdtprlgrreadiknrfvlppfltlk
nfegldlgkmdqasdsglasyvagqidrtlswkdvqwlqtitslpilvkgvltaedarla
vqagaagiivsnhgarqldyvpstimaleevvkaaqgripvfldggvrrgtdvfkalalg
asgifigrpvvfslaaegeagikkvlqmlrdefeltmalsgcrslneitrnhivtewd

Sequence, based on observed residues (ATOM records): (download)

>d5zbmb_ c.1.4.1 (B:) automated matches {Nicotiana benthamiana [TaxId: 4100]}
evtnvmeyeaiakkklpkmvfdyyasgaedqwtlaenrnafsrilfrprilidvskidms
ttvlgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevastgp
girffqlyvykdrnvvaqlvrraeragfkaialtvdtprlgrreadiknrfvlppfltlk
nfegldlgkdsglasyvagqidrtlswkdvqwlqtitslpilvkgvltaedarlavqaga
agiivsnhgarqldyvpstimaleevvkaaqgripvfldggvrrgtdvfkalalgasgif
igrpvvfslaaegeagikkvlqmlrdefeltmalsgcrslneitrnhivtewd

SCOPe Domain Coordinates for d5zbmb_ are not available.

Timeline for d5zbmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5zbma_