![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily) 2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386 |
![]() | Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (2 families) ![]() Pfam PF06236 |
![]() | Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (2 proteins) |
![]() | Protein Tyrosinase cofactor MelC1 [254410] (1 species) |
![]() | Species Streptomyces castaneoglobisporus [TaxId:79261] [254849] (33 PDB entries) |
![]() | Domain d5z0hb_: 5z0h B: [361877] Other proteins in same PDB: d5z0ha1, d5z0ha2 automated match to d2zmzb_ complexed with cu, no3, per |
PDB Entry: 5z0h (more details), 1.18 Å
SCOPe Domain Sequences for d5z0hb_:
Sequence, based on SEQRES records: (download)
>d5z0hb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]} aapesfdevykgrriqgrpagggahhhehgggyevfvdgvqlhvmrnadgswisvvshfd pvptpraaaraavdelqgapllpf
>d5z0hb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]} aapesfdevykgrriqgrpagyevfvdgvqlhvmrnadgswisvvshfdpvptpraaara avdelqgapllpf
Timeline for d5z0hb_: