Lineage for d5z0ka1 (5z0k A:2-273)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332526Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2332527Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2332594Family a.86.1.0: automated matches [254307] (1 protein)
    not a true family
  6. 2332595Protein automated matches [254708] (4 species)
    not a true protein
  7. 2332656Species Streptomyces castaneoglobisporus [TaxId:79261] [361811] (12 PDB entries)
  8. 2332662Domain d5z0ka1: 5z0k A:2-273 [361866]
    Other proteins in same PDB: d5z0ka2, d5z0kb_
    automated match to d4hd7a_
    complexed with cu, no3, per

Details for d5z0ka1

PDB Entry: 5z0k (more details), 1.28 Å

PDB Description: crystal structure of copper-bound tyrosinase from streptomyces castaneoglobisporus in complex with the caddie protein obtained by soaking in the hydroxylamine-containing solution for 4 h at 277 k
PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d5z0ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z0ka1 a.86.1.0 (A:2-273) automated matches {Streptomyces castaneoglobisporus [TaxId: 79261]}
tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
pdvvdlnetmkpwntvrpadlldhtayytfda

SCOPe Domain Coordinates for d5z0ka1:

Click to download the PDB-style file with coordinates for d5z0ka1.
(The format of our PDB-style files is described here.)

Timeline for d5z0ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5z0ka2
View in 3D
Domains from other chains:
(mouse over for more information)
d5z0kb_