Lineage for d6nd8c_ (6nd8 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500013Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2500014Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2500015Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2500166Protein automated matches [190060] (2 species)
    not a true protein
  7. 2500169Species Human (Homo sapiens) [TaxId:9606] [186779] (23 PDB entries)
  8. 2500205Domain d6nd8c_: 6nd8 C: [361857]
    Other proteins in same PDB: d6nd8a_, d6nd8b_, d6nd8d_, d6nd8e_, d6nd8g_, d6nd8h_, d6nd8j_, d6nd8k_, d6nd8m_, d6nd8n_, d6nd8p_, d6nd8q_
    automated match to d1aoxb_
    complexed with ba, cl, na, nh4, so4

Details for d6nd8c_

PDB Entry: 6nd8 (more details), 2.9 Å

PDB Description: rhodocetin in complex with the integrin alpha2-a domain and barium
PDB Compounds: (C:) Integrin alpha-2

SCOPe Domain Sequences for d6nd8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nd8c_ c.62.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
ekagtlgeqif

SCOPe Domain Coordinates for d6nd8c_:

Click to download the PDB-style file with coordinates for d6nd8c_.
(The format of our PDB-style files is described here.)

Timeline for d6nd8c_: