Lineage for d5zbma_ (5zbm A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. Protein automated matches [190228] (20 species)
    not a true protein
  7. Species Nicotiana benthamiana [TaxId:4100] [361819] (2 PDB entries)
  8. Domain d5zbma_: 5zbm A: [361856]
    automated match to d1gyla_
    complexed with fmn

Details for d5zbma_

PDB Entry: 5zbm (more details), 2.8 Å

PDB Description: structure of glycolate oxidase containing fmn from nicotiana benthamiana
PDB Compounds: (A:) glycolate oxidase

SCOPe Domain Sequences for d5zbma_:

Sequence, based on SEQRES records: (download)

>d5zbma_ c.1.4.1 (A:) automated matches {Nicotiana benthamiana [TaxId: 4100]}
evtnvmeyeaiakkklpkmvfdyyasgaedqwtlaenrnafsrilfrprilidvskidms
ttvlgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevastgp
girffqlyvykdrnvvaqlvrraeragfkaialtvdtprlgrreadiknrfvlppfltlk
nfegldlgkmdqasdsglasyvagqidrtlswkdvqwlqtitslpilvkgvltaedarla
vqagaagiivsnhgarqldyvpstimaleevvkaaqgripvfldggvrrgtdvfkalalg
asgifigrpvvfslaaegeagikkvlqmlrdefeltmalsgcrslneitrnhivtewd

Sequence, based on observed residues (ATOM records): (download)

>d5zbma_ c.1.4.1 (A:) automated matches {Nicotiana benthamiana [TaxId: 4100]}
evtnvmeyeaiakkklpkmvfdyyasgaedqwtlaenrnafsrilfrprilidvskidms
ttvlgfkismpimiaptamqkmahpegeyataraasaagtimtlsswatssveevastgp
girffqlyvykdrnvvaqlvrraeragfkaialtvdtprlgrreadiknrfvlppfltlk
nfegldlgkglasyvagqidrtlswkdvqwlqtitslpilvkgvltaedarlavqagaag
iivsnhgarqldyvpstimaleevvkaaqgripvfldggvrrgtdvfkalalgasgifig
rpvvfslaaegeagikkvlqmlrdefeltmalsgcrslneitrnhivtewd

SCOPe Domain Coordinates for d5zbma_ are not available.

Timeline for d5zbma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5zbmb_