Lineage for d5zcba2 (5zcb A:476-555)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. Protein automated matches [226835] (41 species)
    not a true protein
  7. Species Bacillus sp. [TaxId:1409] [361815] (4 PDB entries)
  8. Domain d5zcba2: 5zcb A:476-555 [361846]
    Other proteins in same PDB: d5zcba1
    automated match to d2ze0a2
    complexed with ca

Details for d5zcba2

PDB Entry: 5zcb (more details), 2.5 Å

PDB Description: crystal structure of alpha-glucosidase
PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d5zcba2:

Sequence, based on SEQRES records: (download)

>d5zcba2 b.71.1.0 (A:476-555) automated matches {Bacillus sp. [TaxId: 1409]}
gtykllaeedsaiyaytrtlegktavvicnmspnnqtfefpsessftnievlihnypldk
netleqctlhpyetrvylis

Sequence, based on observed residues (ATOM records): (download)

>d5zcba2 b.71.1.0 (A:476-555) automated matches {Bacillus sp. [TaxId: 1409]}
gtykllaeedsaiyaytrtlegktavvicnmspnnqtfefpssftnievlihnypldkne
tleqctlhpyetrvylis

SCOPe Domain Coordinates for d5zcba2 are not available.

Timeline for d5zcba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zcba1