Lineage for d5zcca1 (5zcc A:4-475)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441105Species Bacillus sp. [TaxId:1409] [356870] (6 PDB entries)
  8. 2441107Domain d5zcca1: 5zcc A:4-475 [361841]
    Other proteins in same PDB: d5zcca2
    automated match to d2ze0a1
    complexed with ca, mal

Details for d5zcca1

PDB Entry: 5zcc (more details), 1.7 Å

PDB Description: crystal structure of alpha-glucosidase in complex with maltose
PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d5zcca1:

Sequence, based on SEQRES records: (download)

>d5zcca1 c.1.8.0 (A:4-475) automated matches {Bacillus sp. [TaxId: 1409]}
kwwkeavayqiyprsfmdsngdgigdiqgviskldylsdlgidviwicpiyqspnddngy
disdykdimkdfgtmedfdelldevhhrgmklimdlvinhtsdehpwflesrsakenpyr
dyyiwhegkdgkepnnwesifsgsawefdektkeyymhvfskkqpdlnwenekvrhelye
mvnwwldkgidgfrvdaishikkvagfpdlpnpekldyvpsfeghmnrpgiqehlkelke
ktfakydimtvgqangvtsdsadewvaedggnfnmifqfehmglwdkgeekpldlielkt
iltnwqnglekingwnalylenhdqirsvnkfgstayrvesakclaalyflmkgtpfiyq
gqelgmtnvkfdsiddyddvgminyyriqrekgdshdeimkviwetgrdnsrtpmqwnte
knagfstgnpwmkvnpnyvdinveeqksdknsvlnfykqlikirkqhdvlvy

Sequence, based on observed residues (ATOM records): (download)

>d5zcca1 c.1.8.0 (A:4-475) automated matches {Bacillus sp. [TaxId: 1409]}
kwwkeavayqiyprsfmdsngdgigdiqgviskldylsdlgidviwicpiyqspnddngy
disdykdimkdfgtmedfdelldevhhrgmklimdlvinhtsdehpwflesrsakenpyr
dyyiwhegkdgkepnnwesifsgsawefdektkeyymhvfskkqpdlnwenekvrhelye
mvnwwldkgidgfrvdaishikkvagfpdlpnpekldyvpsfeghmnrpgiqehlkelke
ktfakydimtvgqangvtsdsadewvaedggnfnmifqfehmglwkpldlielktiltnw
qnglekingwnalylenhdqirsvnkfgstayrvesakclaalyflmkgtpfiyqgqelg
mtnvkfdsiddyddvgminyyriqrekgdshdeimkviwetgrdnsrtpmqwnteknagf
stgnpwmkvnpnyvdinveeqksdknsvlnfykqlikirkqhdvlvy

SCOPe Domain Coordinates for d5zcca1:

Click to download the PDB-style file with coordinates for d5zcca1.
(The format of our PDB-style files is described here.)

Timeline for d5zcca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zcca2