Lineage for d5z0kb_ (5z0k B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011845Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily)
    2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386
  4. 3011846Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (2 families) (S)
    Pfam PF06236
  5. 3011847Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (2 proteins)
  6. 3011848Protein Tyrosinase cofactor MelC1 [254410] (1 species)
  7. 3011849Species Streptomyces castaneoglobisporus [TaxId:79261] [254849] (33 PDB entries)
  8. 3011873Domain d5z0kb_: 5z0k B: [361826]
    Other proteins in same PDB: d5z0ka1, d5z0ka2
    automated match to d2zmzb_
    complexed with cu, no3, per

Details for d5z0kb_

PDB Entry: 5z0k (more details), 1.28 Å

PDB Description: crystal structure of copper-bound tyrosinase from streptomyces castaneoglobisporus in complex with the caddie protein obtained by soaking in the hydroxylamine-containing solution for 4 h at 277 k
PDB Compounds: (B:) MelC

SCOPe Domain Sequences for d5z0kb_:

Sequence, based on SEQRES records: (download)

>d5z0kb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
paapesfdevykgrriqgrpagggahhhehgggyevfvdgvqlhvmrnadgswisvvshf
dpvptpraaaraavdelqgapllpf

Sequence, based on observed residues (ATOM records): (download)

>d5z0kb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
paapesfdevykgrriqgrpagyevfvdgvqlhvmrnadgswisvvshfdpvptpraaar
aavdelqgapllpf

SCOPe Domain Coordinates for d5z0kb_:

Click to download the PDB-style file with coordinates for d5z0kb_.
(The format of our PDB-style files is described here.)

Timeline for d5z0kb_: