Class b: All beta proteins [48724] (178 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Bacillus sp. [TaxId:1409] [361815] (4 PDB entries) |
Domain d5zcea2: 5zce A:476-555 [361816] Other proteins in same PDB: d5zcea1 automated match to d2ze0a2 complexed with ca, mtt |
PDB Entry: 5zce (more details), 1.56 Å
SCOPe Domain Sequences for d5zcea2:
Sequence, based on SEQRES records: (download)
>d5zcea2 b.71.1.0 (A:476-555) automated matches {Bacillus sp. [TaxId: 1409]} gtykllaeedsaiyaytrtlegktavvicnmspnnqtfefpsessftnievlihnypldk netleqctlhpyetrvylis
>d5zcea2 b.71.1.0 (A:476-555) automated matches {Bacillus sp. [TaxId: 1409]} gtykllaeedsaiyaytrtlegktavvicnmspnnqtfefpssftnievlihnypldkne tleqctlhpyetrvylis
Timeline for d5zcea2: