SCOPe 2.08: Domain d5zcea2: 5zce A:476-555

Lineage for d5zcea2 (5zce A:476-555)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Bacillus sp. [TaxId:1409] [361815] (4 PDB entries)

8. Domain d5zcea2: 5zce A:476-555 [361816]
   Other proteins in same PDB: d5zcea1
   automated match to d2ze0a2
   complexed with ca

Details for d5zcea2

PDB Entry: 5zce, 1.56 Å

PDB Description: crystal structure of alpha-glucosidase in complex with maltotetraose

PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d5zcea2:

Sequence, based on SEQRES records:

>d5zcea2 b.71.1.0 (A:476-555) automated matches {Bacillus sp. [TaxId: 1409]}
gtykllaeedsaiyaytrtlegktavvicnmspnnqtfefpsessftnievlihnypldk
netleqctlhpyetrvylis

Sequence, based on observed residues (ATOM records):

>d5zcea2 b.71.1.0 (A:476-555) automated matches {Bacillus sp. [TaxId: 1409]}
gtykllaeedsaiyaytrtlegktavvicnmspnnqtfefpssftnievlihnypldkne
tleqctlhpyetrvylis

Timeline for d5zcea2:

• d5zcea2 first appeared in SCOPe 2.07