SCOPe 2.07: Domain d5z0ib_: 5z0i B:

Lineage for d5z0ib_ (5z0i B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily)
   2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386

4. Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (2 families)
   Pfam PF06236

5. Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (2 proteins)

6. Protein Tyrosinase cofactor MelC1 [254410] (1 species)

7. Species Streptomyces castaneoglobisporus [TaxId:79261] [254849] (33 PDB entries)

8. Domain d5z0ib_: 5z0i B: [361807]
   Other proteins in same PDB: d5z0ia1, d5z0ia2
   automated match to d2zmzb_
   complexed with cu, no3, per

Details for d5z0ib_

PDB Entry: 5z0i, 1.32 Å

PDB Description: crystal structure of copper-bound tyrosinase from streptomyces castaneoglobisporus in complex with the caddie protein obtained by soaking in the hydroxylamine-containing solution for 1 h at 277 k

PDB Compounds: (B:) MelC

SCOPe Domain Sequences for d5z0ib_:

Sequence, based on SEQRES records:

>d5z0ib_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpagggahhhehgggyevfvdgvqlhvmrnadgswisvvshfd
pvptpraaaraavdelqgapllpf

Sequence, based on observed residues (ATOM records):

>d5z0ib_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpaggyevfvdgvqlhvmrnadgswisvvshfdpvptpraaar
aavdelqgapllpf

Timeline for d5z0ib_:

• d5z0ib_ is new in SCOPe 2.07-stable
  
• d5z0ib_ appears in the current release, SCOPe 2.08