Lineage for d6hoea2 (6hoe A:98-214)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. Protein Ethr repressor [109978] (2 species)
  7. Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries)
    Uniprot P96222 22-215
  8. Domain d6hoea2: 6hoe A:98-214 [361803]
    Other proteins in same PDB: d6hoea1
    automated match to d5nima2
    protein/DNA complex; complexed with gh2

Details for d6hoea2

PDB Entry: 6hoe (more details), 1.9 Å

PDB Description: transcriptional repressor ethr from mycobacterium tuberculosis in complex with bdm44850
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d6hoea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hoea2 a.121.1.1 (A:98-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
drenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavidaer
drgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

SCOPe Domain Coordinates for d6hoea2 are not available.

Timeline for d6hoea2:

Domains from same chain:
(mouse over for more information)
d6hoea1