Lineage for d1bnsc_ (1bns C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2494618Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2494619Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2494620Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2494621Protein Barnase [81305] (1 species)
  7. 2494622Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)
  8. 2494726Domain d1bnsc_: 1bns C: [36180]
    mutant

Details for d1bnsc_

PDB Entry: 1bns (more details), 2.05 Å

PDB Description: structural studies of barnase mutants
PDB Compounds: (C:) barnase

SCOPe Domain Sequences for d1bnsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bnsc_ d.1.1.2 (C:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
intfdgvadylqtyhklpdnyiakseaqalgwvaskgnladvapgksiggdifsnregkl
pgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

SCOPe Domain Coordinates for d1bnsc_:

Click to download the PDB-style file with coordinates for d1bnsc_.
(The format of our PDB-style files is described here.)

Timeline for d1bnsc_: