SCOPe 2.08: Domain d1bnsc_: 1bns C:

Lineage for d1bnsc_ (1bns C:)

1. Root: SCOPe 2.08
2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet
4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)
5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
6. Protein Barnase [81305] (1 species)
7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)
8. Domain d1bnsc_: 1bns C: [36180]
   mutant

Details for d1bnsc_

PDB Entry: 1bns, 2.05 Å

PDB Description: structural studies of barnase mutants

PDB Compounds: (C:) barnase

SCOPe Domain Sequences for d1bnsc_:

Sequence; same for both SEQRES and ATOM records:

>d1bnsc_ d.1.1.2 (C:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
intfdgvadylqtyhklpdnyiakseaqalgwvaskgnladvapgksiggdifsnregkl
pgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

SCOPe Domain Coordinates for d1bnsc_ are not available.

Timeline for d1bnsc_:

• d1bnsc_ first appeared (with stable ids) in SCOP 1.55
  
• d1bnsc_ appears in SCOPe 2.07