SCOPe 2.08: Domain d6ho9a2: 6ho9 A:98-214

Lineage for d6ho9a2 (6ho9 A:98-214)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Ethr repressor [109978] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries)
   Uniprot P96222 22-215

8. Domain d6ho9a2: 6ho9 A:98-214 [361793]
   Other proteins in same PDB: d6ho9a1
   automated match to d5nima2
   protein/DNA complex; complexed with ghb

Details for d6ho9a2

PDB Entry: 6ho9, 1.8 Å

PDB Description: transcriptional repressor ethr from mycobacterium tuberculosis in complex with bdm44825

PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d6ho9a2:

Sequence; same for both SEQRES and ATOM records:

>d6ho9a2 a.121.1.1 (A:98-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
drenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavidaer
drgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

Timeline for d6ho9a2:

• d6ho9a2 first appeared in SCOPe 2.07