SCOPe 2.07: Domain d6ho7a2: 6ho7 A:95-214

Lineage for d6ho7a2 (6ho7 A:95-214)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Ethr repressor [109978] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries)
   Uniprot P96222 22-215

8. Domain d6ho7a2: 6ho7 A:95-214 [361774]
   Other proteins in same PDB: d6ho7a1
   automated match to d5nima2
   protein/DNA complex; complexed with ghq

Details for d6ho7a2

PDB Entry: 6ho7, 2.5 Å

PDB Description: transcriptional repressor ethr from mycobacterium tuberculosis in complex with bdm44814

PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d6ho7a2:

Sequence; same for both SEQRES and ATOM records:

>d6ho7a2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

Timeline for d6ho7a2:

• d6ho7a2 is new in SCOPe 2.07-stable
  
• d6ho7a2 appears in the current release, SCOPe 2.08