Lineage for d1bseb_ (1bse B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2923793Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2923794Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2923795Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2923796Protein Barnase [81305] (1 species)
  7. 2923797Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)
  8. 2923897Domain d1bseb_: 1bse B: [36176]
    mutant

Details for d1bseb_

PDB Entry: 1bse (more details), 2 Å

PDB Description: crystal structural analysis of mutations in the hydrophobic cores of barnase
PDB Compounds: (B:) barnase

SCOPe Domain Sequences for d1bseb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bseb_ d.1.1.2 (B:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrivyssdwliykttdhyqtftkir

SCOPe Domain Coordinates for d1bseb_:

Click to download the PDB-style file with coordinates for d1bseb_.
(The format of our PDB-style files is described here.)

Timeline for d1bseb_: