SCOPe 2.07: Domain d5o2fa1: 5o2f A:29-270

Lineage for d5o2fa1 (5o2f A:29-270)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)

8. Domain d5o2fa1: 5o2f A:29-270 [361748]
   Other proteins in same PDB: d5o2fa2, d5o2fb2
   automated match to d5zh1b_
   complexed with cl, edo, so4, zn, zz7

Details for d5o2fa1

PDB Entry: 5o2f, 2.01 Å

PDB Description: crystal structure of ndm-1 in complex with hydrolyzed ampicillin - new refinement

PDB Compounds: (A:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d5o2fa1:

Sequence; same for both SEQRES and ATOM records:

>d5o2fa1 d.157.1.0 (A:29-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv
vdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnql
apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc
likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk
lr

Timeline for d5o2fa1:

• d5o2fa1 is new in SCOPe 2.07-stable
  
• d5o2fa1 appears in the current release, SCOPe 2.08