Lineage for d6ncra_ (6ncr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2860890Species Chlamydia trachomatis [TaxId:272561] [361720] (1 PDB entry)
  8. 2860891Domain d6ncra_: 6ncr A: [361721]
    Other proteins in same PDB: d6ncrb2
    automated match to d5v0ib_
    complexed with act, ca, edo, trp

Details for d6ncra_

PDB Entry: 6ncr (more details), 1.75 Å

PDB Description: crystal structure of tryptophan-trna ligase from chlamydia trachomatis with bound l-tryptophan
PDB Compounds: (A:) Tryptophan--tRNA ligase

SCOPe Domain Sequences for d6ncra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ncra_ c.26.1.0 (A:) automated matches {Chlamydia trachomatis [TaxId: 272561]}
kkkrvltgdrptgklhlghwigsimnrlqlqndsrydcffiiadlhtlttktrkeeilqi
dnhiydvladwlsvgidpeksaiylqsaipeiyelnlifsmltplnhimgipsikemarn
aslneeslshgligypvlqsadillakahlvpvgkdneahveltrdiaktfnrlygevfp
epdilqgeltalvgtngqgkmsksannaiylsddaktvqekirklytdpnrihattpgrv
egnplfiyhdlfnphkeeveefktryrqgcirdvevkarlaeeinlflnpfrekrselva
qpkfleealqqgtekmrtvaretmeevhdhlglsrkwrtila

SCOPe Domain Coordinates for d6ncra_:

Click to download the PDB-style file with coordinates for d6ncra_.
(The format of our PDB-style files is described here.)

Timeline for d6ncra_: