Lineage for d6hwza_ (6hwz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811457Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2811458Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2811459Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2812658Protein automated matches [190681] (2 species)
    not a true protein
  7. 2812668Species Human (Homo sapiens) [TaxId:9606] [187805] (57 PDB entries)
  8. 2812728Domain d6hwza_: 6hwz A: [361695]
    automated match to d3d0na_
    complexed with gxe, zn

Details for d6hwza_

PDB Entry: 6hwz (more details), 1.64 Å

PDB Description: selenols: a new class of carbonic anhydrase inhibitors
PDB Compounds: (A:) Carbonic anhydrase 1

SCOPe Domain Sequences for d6hwza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hwza_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
sfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
nrptqplkgrtvrasf

SCOPe Domain Coordinates for d6hwza_:

Click to download the PDB-style file with coordinates for d6hwza_.
(The format of our PDB-style files is described here.)

Timeline for d6hwza_: