Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) |
Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins) |
Protein Barnase [81305] (1 species) |
Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries) |
Domain d1bsaa_: 1bsa A: [36169] mutant |
PDB Entry: 1bsa (more details), 2 Å
SCOPe Domain Sequences for d1bsaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bsaa_ d.1.1.2 (A:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]} intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksvggdifsnregkl pgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
Timeline for d1bsaa_: