Lineage for d6ho6a1 (6ho6 A:24-93)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. Protein automated matches [190674] (25 species)
    not a true protein
  7. Species Mycobacterium tuberculosis [TaxId:83331] [313822] (25 PDB entries)
  8. Domain d6ho6a1: 6ho6 A:24-93 [361680]
    Other proteins in same PDB: d6ho6a2
    automated match to d5nima1
    protein/DNA complex; complexed with ggk

Details for d6ho6a1

PDB Entry: 6ho6 (more details), 1.9 Å

PDB Description: transcriptional repressor ethr from mycobacterium tuberculosis in complex with bdm44725
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d6ho6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ho6a1 a.4.1.0 (A:24-93) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
drelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvnqa
dmalqtlaen

SCOPe Domain Coordinates for d6ho6a1 are not available.

Timeline for d6ho6a1:

Domains from same chain:
(mouse over for more information)
d6ho6a2