Lineage for d1bnfc_ (1bnf C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. Protein Barnase [81305] (1 species)
  7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)
  8. Domain d1bnfc_: 1bnf C: [36168]
    mutant

Details for d1bnfc_

PDB Entry: 1bnf (more details), 2 Å

PDB Description: barnase t70c/s92c disulfide mutant
PDB Compounds: (C:) barnase

SCOPe Domain Sequences for d1bnfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bnfc_ d.1.1.2 (C:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl
pgksgrcwreadinytsgfrnsdrilyscdwliykttdhyqtftkir

SCOPe Domain Coordinates for d1bnfc_ are not available.

Timeline for d1bnfc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bnfa_, d1bnfb_