SCOPe 2.08: Domain d6fs2a1: 6fs2 A:174-325

Lineage for d6fs2a1 (6fs2 A:174-325)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [188549] (62 PDB entries)

8. Domain d6fs2a1: 6fs2 A:174-325 [361663]
   Other proteins in same PDB: d6fs2a2, d6fs2b2
   automated match to d2kbwa_
   complexed with e4k

Details for d6fs2a1

PDB Entry: 6fs2, 2.55 Å

PDB Description: mcl1 in complex with indole acid ligand

PDB Compounds: (A:) Induced myeloid leukemia cell differentiation protein Mcl-1

SCOPe Domain Sequences for d6fs2a1:

Sequence, based on SEQRES records:

>d6fs2a1 f.1.4.1 (A:174-325) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Human (Homo sapiens) [TaxId: 9606]}
lyrqsleiisrylreqatgskdtkplgeagaagrraletlrrvgdgvqrnhetafqgmlr
kldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaes
itdvlvrtkrdwlvkqrgwdgfveffhvedle

Sequence, based on observed residues (ATOM records):

>d6fs2a1 f.1.4.1 (A:174-325) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Human (Homo sapiens) [TaxId: 9606]}
lyrqsleiisrylreqatgskdplgeagaagrraletlrrvgdgvqrnhetafqgmlrkl
dikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaesit
dvlvrtkrdwlvkqrgwdgfveffhvedle

Timeline for d6fs2a1:

• d6fs2a1 first appeared in SCOPe 2.07