SCOPe 2.08: Domain d6fs1b1: 6fs1 B:174-321

Lineage for d6fs1b1 (6fs1 B:174-321)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [188549] (62 PDB entries)

8. Domain d6fs1b1: 6fs1 B:174-321 [361644]
   Other proteins in same PDB: d6fs1a2, d6fs1b2
   automated match to d3d7va_
   complexed with e4q, edo

Details for d6fs1b1

PDB Entry: 6fs1, 1.6 Å

PDB Description: mcl1 in complex with an indole acid ligand

PDB Compounds: (B:) Induced myeloid leukemia cell differentiation protein Mcl-1

SCOPe Domain Sequences for d6fs1b1:

Sequence; same for both SEQRES and ATOM records:

>d6fs1b1 f.1.4.1 (B:174-321) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Human (Homo sapiens) [TaxId: 9606]}
lyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgmlr
kldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaes
itdvlvrtkrdwlvkqrgwdgfveffhv

Timeline for d6fs1b1:

• d6fs1b1 first appeared in SCOPe 2.07