SCOP 1.73: Domain d1brjc_: 1brj C:

Lineage for d1brjc_ (1brj C:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (43 PDB entries)

8. Domain d1brjc_: 1brj C: [36162]
   complexed with zn; mutant

Details for d1brjc_

PDB Entry: 1brj, 2 Å

PDB Description: barnase mutant with ile 88 replaced by ala

PDB Compounds: (C:) barnase

SCOP Domain Sequences for d1brjc_:

Sequence; same for both SEQRES and ATOM records:

>d1brjc_ d.1.1.2 (C:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdralyssdwliykttdhyqtftkir

Timeline for d1brjc_:

• d1brjc_ first appeared (with stable ids) in SCOP 1.55
  
• d1brjc_ appears in SCOP 1.71
  
• d1brjc_ appears in SCOP 1.75
  
• d1brjc_ appears in the current release, SCOPe 2.08