SCOP 1.59: Domain d1brjc_: 1brj C:

Lineage for d1brjc_ (1brj C:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)

4. Superfamily d.1.1: Microbial ribonucleases [53933] (1 family)

5. Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)

6. Protein Barnase/Binase [53944] (2 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (33 PDB entries)

8. Domain d1brjc_: 1brj C: [36162]

Details for d1brjc_

PDB Entry: 1brj, 2 Å

PDB Description: barnase mutant with ile 88 replaced by ala

SCOP Domain Sequences for d1brjc_:

Sequence; same for both SEQRES and ATOM records:

>d1brjc_ d.1.1.1 (C:) Barnase/Binase {Bacillus amyloliquefaciens}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdralyssdwliykttdhyqtftkir

Timeline for d1brjc_:

• d1brjc_ first appeared (with stable ids) in SCOP 1.55
  
• d1brjc_ appears in SCOP 1.57
  
• d1brjc_ appears in SCOP 1.61
  
• d1brjc_ appears in the current release, SCOPe 2.08