Lineage for d1brjc_ (1brj C:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28524Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
  4. 28525Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) (S)
  5. 28526Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)
  6. 28527Protein Barnase/Binase [53944] (2 species)
  7. 28528Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (33 PDB entries)
  8. 28554Domain d1brjc_: 1brj C: [36162]

Details for d1brjc_

PDB Entry: 1brj (more details), 2 Å

PDB Description: barnase mutant with ile 88 replaced by ala

SCOP Domain Sequences for d1brjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brjc_ d.1.1.1 (C:) Barnase/Binase {Bacillus amyloliquefaciens}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdralyssdwliykttdhyqtftkir

SCOP Domain Coordinates for d1brjc_:

Click to download the PDB-style file with coordinates for d1brjc_.
(The format of our PDB-style files is described here.)

Timeline for d1brjc_: