Lineage for d6a1ta_ (6a1t A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2388863Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2389129Protein automated matches [190029] (5 species)
    not a true protein
  7. 2389137Species Human (Homo sapiens) [TaxId:9606] [186749] (38 PDB entries)
  8. 2389170Domain d6a1ta_: 6a1t A: [361606]
    automated match to d1g86a_
    complexed with lat

Details for d6a1ta_

PDB Entry: 6a1t (more details), 1.97 Å

PDB Description: charcot-leyden crystal protein/galectin-10 variant e33a with lactose
PDB Compounds: (A:) Galectin-10

SCOPe Domain Sequences for d6a1ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a1ta_ b.29.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sllpvpyteaaslstgstvtikgrplacflnapylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvsylkr

SCOPe Domain Coordinates for d6a1ta_:

Click to download the PDB-style file with coordinates for d6a1ta_.
(The format of our PDB-style files is described here.)

Timeline for d6a1ta_: