Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
Protein automated matches [190029] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186749] (38 PDB entries) |
Domain d6a1ta_: 6a1t A: [361606] automated match to d1g86a_ complexed with lat |
PDB Entry: 6a1t (more details), 1.97 Å
SCOPe Domain Sequences for d6a1ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a1ta_ b.29.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sllpvpyteaaslstgstvtikgrplacflnapylqvdfhtemkeesdivfhfqvcfgrr vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav kmvqvwrdisltkfnvsylkr
Timeline for d6a1ta_: