Lineage for d1brja_ (1brj A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 75820Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
  4. 75821Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) (S)
  5. 75822Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)
  6. 75823Protein Barnase/Binase [53944] (2 species)
  7. 75824Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (33 PDB entries)
  8. 75848Domain d1brja_: 1brj A: [36160]

Details for d1brja_

PDB Entry: 1brj (more details), 2 Å

PDB Description: barnase mutant with ile 88 replaced by ala

SCOP Domain Sequences for d1brja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brja_ d.1.1.1 (A:) Barnase/Binase {Bacillus amyloliquefaciens}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdralyssdwliykttdhyqtftkir

SCOP Domain Coordinates for d1brja_:

Click to download the PDB-style file with coordinates for d1brja_.
(The format of our PDB-style files is described here.)

Timeline for d1brja_: