Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
Protein automated matches [227005] (6 species) not a true protein |
Species Geobacillus stearothermophilus [TaxId:272567] [361597] (1 PDB entry) |
Domain d6acff2: 6acf F:135-367 [361598] Other proteins in same PDB: d6acfa1, d6acfb1, d6acfc1, d6acfd1, d6acfe1, d6acff1, d6acfg1, d6acfh1 automated match to d1leha1 |
PDB Entry: 6acf (more details), 3 Å
SCOPe Domain Sequences for d6acff2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6acff2 c.2.1.7 (F:135-367) automated matches {Geobacillus stearothermophilus [TaxId: 272567]} gispefgssgnpspataygvyrgmkaaakeafgsdslegkvvavqgvgnvayhlcrhlhe egaklivtdinkeavaraveefgakavdpndiygvecdifapcalggiindqtipqlkak viagsannqlkeprhgdmihemgivyapdyvinaggvinvadelygynreramkkieqiy dniekvfaiakrdniptyvaadrmaeerietmrkarsqflqnghhilsrrrar
Timeline for d6acff2: