Lineage for d6acfb1 (6acf B:1-134)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. Protein automated matches [226864] (38 species)
    not a true protein
  7. Species Geobacillus stearothermophilus [TaxId:272567] [361594] (1 PDB entry)
  8. Domain d6acfb1: 6acf B:1-134 [361595]
    Other proteins in same PDB: d6acfa2, d6acfb2, d6acfc2, d6acfd2, d6acfe2, d6acff2, d6acfg2, d6acfh2
    automated match to d1leha2

Details for d6acfb1

PDB Entry: 6acf (more details), 3 Å

PDB Description: structure of leucine dehydrogenase from geobacillus stearothermophilus by cryo-em
PDB Compounds: (B:) leucine dehydrogenase

SCOPe Domain Sequences for d6acfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6acfb1 c.58.1.0 (B:1-134) automated matches {Geobacillus stearothermophilus [TaxId: 272567]}
melfqymekydyeqvlfcqdkesglkaiivihdttlgpalggtrmwmynseeealedalr
largmtyknaaaglnlgggktviigdprkdkneamfrafgrfiqglngryitaedvgttv
admdiiyqetdyvt

SCOPe Domain Coordinates for d6acfb1 are not available.

Timeline for d6acfb1:

Domains from same chain:
(mouse over for more information)
d6acfb2
Domains from other chains:
(mouse over for more information)
d6acfa1, d6acfa2, d6acfc1, d6acfc2, d6acfd1, d6acfd2, d6acfe1, d6acfe2, d6acff1, d6acff2, d6acfg1, d6acfg2, d6acfh1, d6acfh2